| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries) |
| Domain d3iu1a1: 3iu1 A:115-295 [211952] automated match to d1iyka1 complexed with mya |
PDB Entry: 3iu1 (more details), 1.42 Å
SCOPe Domain Sequences for d3iu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iu1a1 d.108.1.0 (A:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
r
Timeline for d3iu1a1: