SCOPe 2.06: Domain d3ithc2: 3ith C:430-556

Lineage for d3ithc2 (3ith C:430-556)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d3ithc2: 3ith C:430-556 [211950]
   Other proteins in same PDB: d3itha1, d3ithb_, d3ithc1, d3ithd_
   automated match to d1ikwa1
   complexed with edm

Details for d3ithc2

PDB Entry: 3ith, 2.8 Å

PDB Description: Crystal structure of the HIV-1 reverse transcriptase bound to a 6-vinylpyrimidine inhibitor

PDB Compounds: (C:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3ithc2:

Sequence; same for both SEQRES and ATOM records:

>d3ithc2 c.55.3.1 (C:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

Timeline for d3ithc2:

• d3ithc2 first appeared in SCOPe 2.03
  
• d3ithc2 appears in SCOPe 2.05
  
• d3ithc2 appears in SCOPe 2.07
  
• d3ithc2 appears in the current release, SCOPe 2.08