SCOPe 2.03: Domain d3ithc1: 3ith C:1-429

Lineage for d3ithc1 (3ith C:1-429)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (138 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d3ithc1: 3ith C:1-429 [211949]
   Other proteins in same PDB: d3itha2, d3ithc2
   automated match to d1ikwa2
   complexed with edm

Details for d3ithc1

PDB Entry: 3ith, 2.8 Å

PDB Description: Crystal structure of the HIV-1 reverse transcriptase bound to a 6-vinylpyrimidine inhibitor

PDB Compounds: (C:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3ithc1:

Sequence; same for both SEQRES and ATOM records:

>d3ithc1 e.8.1.2 (C:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d3ithc1:

• d3ithc1 is new in SCOPe 2.03-stable
  
• d3ithc1 appears in SCOPe 2.04
  
• d3ithc1 appears in the current release, SCOPe 2.08