Lineage for d3itgb2 (3itg B:262-610)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089931Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2089977Family c.1.23.2: Proline dehydrohenase domain of bifunctional PutA protein [82279] (2 protein domains)
    automatically mapped to Pfam PF01619
  6. 2089978Protein Proline dehydrohenase domain of bifunctional PutA protein [82280] (2 species)
  7. 2089979Species Escherichia coli K-12 [TaxId:83333] [224879] (3 PDB entries)
  8. 2089983Domain d3itgb2: 3itg B:262-610 [211945]
    Other proteins in same PDB: d3itga1, d3itgb1
    automated match to d1tj1a2
    complexed with fda

Details for d3itgb2

PDB Entry: 3itg (more details), 2.15 Å

PDB Description: Structure the proline utilization A proline dehydrogenase domain (PutA86-630) inactivated with N-propargylglycine
PDB Compounds: (B:) Bifunctional protein putA

SCOPe Domain Sequences for d3itgb2:

Sequence, based on SEQRES records: (download)

>d3itgb2 c.1.23.2 (B:262-610) Proline dehydrohenase domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]}
getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy
egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisl
dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse
ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq
nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrlleng
antsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprd

Sequence, based on observed residues (ATOM records): (download)

>d3itgb2 c.1.23.2 (B:262-610) Proline dehydrohenase domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]}
getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy
egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisl
dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse
ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq
nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrgantsf
vnriadtslpldelvadpvtaveklaqqegqtglphpkiplprd

SCOPe Domain Coordinates for d3itgb2:

Click to download the PDB-style file with coordinates for d3itgb2.
(The format of our PDB-style files is described here.)

Timeline for d3itgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3itgb1