SCOPe 2.08: Domain d3itga1: 3itg A:87-261

Lineage for d3itga1 (3itg A:87-261)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
   multihelical; array

4. Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families)

5. Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)

6. Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
   includes the N-terminal swapping arm made of three helices; possible DNA-binding function

7. Species Escherichia coli K-12 [TaxId:83333] [224851] (1 PDB entry)

8. Domain d3itga1: 3itg A:87-261 [211942]
   Other proteins in same PDB: d3itga2, d3itgb2
   automated match to d1tj1a1
   complexed with fda
   fragment; missing more than one-third of the common structure and/or sequence

Details for d3itga1

PDB Entry: 3itg, 2.15 Å

PDB Description: Structure the proline utilization A proline dehydrogenase domain (PutA86-630) inactivated with N-propargylglycine

PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d3itga1:

Sequence, based on SEQRES records:

>d3itga1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records):

>d3itga1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqfvt

Timeline for d3itga1:

• d3itga1 first appeared in SCOPe 2.03
  
• d3itga1 appears in SCOPe 2.07