Lineage for d3itga1 (3itg A:87-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014214Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 2014215Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 2014216Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)
  6. 2014217Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
    includes the N-terminal swapping arm made of three helices; possible DNA-binding function
  7. 2014218Species Escherichia coli K-12 [TaxId:83333] [224851] (1 PDB entry)
  8. 2014219Domain d3itga1: 3itg A:87-261 [211942]
    Other proteins in same PDB: d3itga2, d3itgb2
    automated match to d1tj1a1
    complexed with fda

Details for d3itga1

PDB Entry: 3itg (more details), 2.15 Å

PDB Description: Structure the proline utilization A proline dehydrogenase domain (PutA86-630) inactivated with N-propargylglycine
PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d3itga1:

Sequence, based on SEQRES records: (download)

>d3itga1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d3itga1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqfvt

SCOPe Domain Coordinates for d3itga1:

Click to download the PDB-style file with coordinates for d3itga1.
(The format of our PDB-style files is described here.)

Timeline for d3itga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3itga2