![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily) multihelical; array |
![]() | Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) ![]() |
![]() | Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein) |
![]() | Protein N-terminal domain of bifunctional PutA protein [81937] (2 species) includes the N-terminal swapping arm made of three helices; possible DNA-binding function |
![]() | Species Escherichia coli K-12 [TaxId:83333] [224851] (1 PDB entry) |
![]() | Domain d3itga1: 3itg A:87-261 [211942] Other proteins in same PDB: d3itga2, d3itgb2 automated match to d1tj1a1 complexed with fda fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3itg (more details), 2.15 Å
SCOPe Domain Sequences for d3itga1:
Sequence, based on SEQRES records: (download)
>d3itga1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]} pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt
>d3itga1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli K-12 [TaxId: 83333]} pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqfvt
Timeline for d3itga1: