SCOP 1.61: Domain d2hrpl2: 2hrp L:108-211

Lineage for d2hrpl2 (2hrp L:108-211)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab F11.2.32 (mouse), kappa L chain [49049] (2 PDB entries)

8. Domain d2hrpl2: 2hrp L:108-211 [21194]
   Other proteins in same PDB: d2hrph1, d2hrpl1, d2hrpm1, d2hrpn1

Details for d2hrpl2

PDB Entry: 2hrp, 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrpl2:

Sequence; same for both SEQRES and ATOM records:

>d2hrpl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2hrpl2:

• d2hrpl2 first appeared (with stable ids) in SCOP 1.55
  
• d2hrpl2 appears in SCOP 1.59
  
• d2hrpl2 appears in SCOP 1.63
  
• d2hrpl2 appears in the current release, SCOPe 2.08