SCOPe 2.03: Domain d3isqa1: 3isq A:9-156

Lineage for d3isqa1 (3isq A:9-156)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189952] (2 PDB entries)

8. Domain d3isqa1: 3isq A:9-156 [211939]
   Other proteins in same PDB: d3isqa2
   automated match to d1sqia1
   complexed with cl, co, edo, na

Details for d3isqa1

PDB Entry: 3isq, 1.75 Å

PDB Description: crystal structure of human 4-hydroxyphenylpyruvate dioxygenase

PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d3isqa1:

Sequence; same for both SEQRES and ATOM records:

>d3isqa1 d.32.1.0 (A:9-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvshvikqgkiv
fvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimrepwveqdkf
gkvkfavlqtygdtthtlvekmnyigqf

Timeline for d3isqa1:

• d3isqa1 is new in SCOPe 2.03-stable
  
• d3isqa1 appears in SCOPe 2.04
  
• d3isqa1 appears in the current release, SCOPe 2.08