Lineage for d3isqa1 (3isq A:9-174)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942578Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2942579Species Human (Homo sapiens) [TaxId:9606] [110878] (1 PDB entry)
  8. 2942580Domain d3isqa1: 3isq A:9-174 [211939]
    automated match to d1sqia1
    complexed with cl, co, edo, na

Details for d3isqa1

PDB Entry: 3isq (more details), 1.75 Å

PDB Description: crystal structure of human 4-hydroxyphenylpyruvate dioxygenase
PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d3isqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3isqa1 d.32.1.3 (A:9-174) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]}
akpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvshvikqgkiv
fvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimrepwveqdkf
gkvkfavlqtygdtthtlvekmnyigqflpgyeapafmdpllpklp

SCOPe Domain Coordinates for d3isqa1:

Click to download the PDB-style file with coordinates for d3isqa1.
(The format of our PDB-style files is described here.)

Timeline for d3isqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3isqa2