Lineage for d3isqa1 (3isq A:9-174)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) 
Species Human (Homo sapiens) [TaxId:9606] [110878] (1 PDB entry) 
Domain d3isqa1: 3isq A:9-174 [211939]
automated match to d1sqia1
complexed with cl, co, edo, na
Details for d3isqa1
PDB Entry: 3isq (more details), 1.75 Å
PDB Description: crystal structure of human 4-hydroxyphenylpyruvate dioxygenase
PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenaseSCOPe Domain Sequences for d3isqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3isqa1 d.32.1.3 (A:9-174) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]}
akpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvshvikqgkiv
fvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimrepwveqdkf
gkvkfavlqtygdtthtlvekmnyigqflpgyeapafmdpllpklp
SCOPe Domain Coordinates for d3isqa1:
Click to download the PDB-style file with coordinates for d3isqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3isqa1:
- d3isqa1 first appeared in SCOPe 2.03
- d3isqa1 appears in SCOPe 2.07
View in 3D
