Lineage for d3isob2 (3iso B:81-218)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327072Species Clonorchis sinensis [TaxId:79923] [225958] (3 PDB entries)
  8. 2327074Domain d3isob2: 3iso B:81-218 [211938]
    Other proteins in same PDB: d3isoa1, d3isob1
    automated match to d1bg5a1
    complexed with gsh, so4, zn

Details for d3isob2

PDB Entry: 3iso (more details), 1.9 Å

PDB Description: crystal structure of 26 kda gst of clonorchis sinensis in p3221 symmetry
PDB Compounds: (B:) putative glutathione transferase

SCOPe Domain Sequences for d3isob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3isob2 a.45.1.0 (B:81-218) automated matches {Clonorchis sinensis [TaxId: 79923]}
migntpverakismiegglvdlragvsriayqetfeqlkvpylqqlpstlrmwsqflgnn
sylhgstpthldfmfyealdviryldptsveafpnlmqfihriealpnikafmesdrfik
wplngwsayfgggdappk

SCOPe Domain Coordinates for d3isob2:

Click to download the PDB-style file with coordinates for d3isob2.
(The format of our PDB-style files is described here.)

Timeline for d3isob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3isob1