| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (71 species) not a true protein |
| Species Clonorchis sinensis [TaxId:79923] [225958] (3 PDB entries) |
| Domain d3isob2: 3iso B:81-218 [211938] Other proteins in same PDB: d3isoa1, d3isob1 automated match to d1bg5a1 complexed with gsh, so4, zn |
PDB Entry: 3iso (more details), 1.9 Å
SCOPe Domain Sequences for d3isob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3isob2 a.45.1.0 (B:81-218) automated matches {Clonorchis sinensis [TaxId: 79923]}
migntpverakismiegglvdlragvsriayqetfeqlkvpylqqlpstlrmwsqflgnn
sylhgstpthldfmfyealdviryldptsveafpnlmqfihriealpnikafmesdrfik
wplngwsayfgggdappk
Timeline for d3isob2: