| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (147 species) not a true protein |
| Species Clonorchis sinensis [TaxId:79923] [225957] (3 PDB entries) |
| Domain d3isob1: 3iso B:1-80 [211937] Other proteins in same PDB: d3isoa2, d3isob2 automated match to d1m9aa2 complexed with gsh, so4, zn |
PDB Entry: 3iso (more details), 1.9 Å
SCOPe Domain Sequences for d3isob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3isob1 c.47.1.0 (B:1-80) automated matches {Clonorchis sinensis [TaxId: 79923]}
mapvlgywkirglaqpirllleyvgdsyeehsygrcdgekwqndkhnlglelpnlpyykd
gnfsltqslailryiadkhn
Timeline for d3isob1: