Lineage for d3isoa1 (3iso A:1-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487306Species Clonorchis sinensis [TaxId:79923] [225957] (3 PDB entries)
  8. 2487307Domain d3isoa1: 3iso A:1-80 [211935]
    Other proteins in same PDB: d3isoa2, d3isob2
    automated match to d1m9aa2
    complexed with gsh, so4, zn

Details for d3isoa1

PDB Entry: 3iso (more details), 1.9 Å

PDB Description: crystal structure of 26 kda gst of clonorchis sinensis in p3221 symmetry
PDB Compounds: (A:) putative glutathione transferase

SCOPe Domain Sequences for d3isoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3isoa1 c.47.1.0 (A:1-80) automated matches {Clonorchis sinensis [TaxId: 79923]}
mapvlgywkirglaqpirllleyvgdsyeehsygrcdgekwqndkhnlglelpnlpyykd
gnfsltqslailryiadkhn

SCOPe Domain Coordinates for d3isoa1:

Click to download the PDB-style file with coordinates for d3isoa1.
(The format of our PDB-style files is described here.)

Timeline for d3isoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3isoa2