Lineage for d1hyyh2 (1hyy H:114-215)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365227Domain d1hyyh2: 1hyy H:114-215 [21193]
    Other proteins in same PDB: d1hyyh1, d1hyyl1, d1hyyl2
    part of hydrolytic antibody 6D9
    complexed with cpd

Details for d1hyyh2

PDB Entry: 1hyy (more details), 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyyh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyyh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1hyyh2:

Click to download the PDB-style file with coordinates for d1hyyh2.
(The format of our PDB-style files is described here.)

Timeline for d1hyyh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyyh1