![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fab 6D9 (mouse), kappa L chain [49048] (2 PDB entries) |
![]() | Domain d1hyyh2: 1hyy H:114-215 [21193] Other proteins in same PDB: d1hyyh1, d1hyyl1 |
PDB Entry: 1hyy (more details), 1.8 Å
SCOP Domain Sequences for d1hyyh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyyh2 b.1.1.2 (H:114-215) Immunoglobulin (constant domains of L and H chains) {Fab 6D9 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d1hyyh2: