Lineage for d3isfc_ (3isf C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1264992Protein automated matches [190041] (22 species)
    not a true protein
  7. 1265303Species Pseudomonas aeruginosa [TaxId:287] [189215] (5 PDB entries)
  8. 1265312Domain d3isfc_: 3isf C: [211928]
    automated match to d4e6kf_
    complexed with hem, k

Details for d3isfc_

PDB Entry: 3isf (more details), 2.07 Å

PDB Description: structure of non-mineralized bfrb (as-isolated) from pseudomonas aeruginosa to 2.07a resolution
PDB Compounds: (C:) bacterioferritin

SCOPe Domain Sequences for d3isfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3isfc_ a.25.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
dileseeehidyletqlgliqkvglenylqshmhed

SCOPe Domain Coordinates for d3isfc_:

Click to download the PDB-style file with coordinates for d3isfc_.
(The format of our PDB-style files is described here.)

Timeline for d3isfc_: