SCOP 1.55: Domain d1hyyl2: 1hyy L:108-211

Lineage for d1hyyl2 (1hyy L:108-211)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 6D9 (mouse), kappa L chain [49048] (2 PDB entries)

8. Domain d1hyyl2: 1hyy L:108-211 [21192]
   Other proteins in same PDB: d1hyyh1, d1hyyl1

Details for d1hyyl2

PDB Entry: 1hyy, 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyyl2:

Sequence; same for both SEQRES and ATOM records:

>d1hyyl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 6D9 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1hyyl2:

• d1hyyl2 appears in SCOP 1.57
  
• d1hyyl2 last appears in SCOP 1.73