Lineage for d1hyyl2 (1hyy L:108-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8783Species Fab 6D9 (mouse), kappa L chain [49048] (2 PDB entries)
  8. 8787Domain d1hyyl2: 1hyy L:108-211 [21192]
    Other proteins in same PDB: d1hyyh1, d1hyyl1

Details for d1hyyl2

PDB Entry: 1hyy (more details), 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyyl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyyl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 6D9 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1hyyl2:

Click to download the PDB-style file with coordinates for d1hyyl2.
(The format of our PDB-style files is described here.)

Timeline for d1hyyl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyyl1