Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (24 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189215] (12 PDB entries) |
Domain d3iseq_: 3ise Q: [211918] automated match to d3is7s_ complexed with fe, hem, k |
PDB Entry: 3ise (more details), 2.8 Å
SCOPe Domain Sequences for d3iseq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iseq_ a.25.1.1 (Q:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd ileseeehidyletqlgliqkvglenylqshmhe
Timeline for d3iseq_: