Lineage for d3isee_ (3ise E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990774Species Pseudomonas aeruginosa [TaxId:287] [189215] (12 PDB entries)
  8. 1990911Domain d3isee_: 3ise E: [211906]
    automated match to d3is7s_
    complexed with fe, hem, k

Details for d3isee_

PDB Entry: 3ise (more details), 2.8 Å

PDB Description: structure of mineralized bfrb (double soak) from pseudomonas aeruginosa to 2.8a resolution
PDB Compounds: (E:) bacterioferritin

SCOPe Domain Sequences for d3isee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3isee_ a.25.1.1 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
ileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d3isee_:

Click to download the PDB-style file with coordinates for d3isee_.
(The format of our PDB-style files is described here.)

Timeline for d3isee_: