SCOP 1.65: Domain d1hyxl2: 1hyx L:108-211

Lineage for d1hyxl2 (1hyx L:108-211)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1hyxl2: 1hyx L:108-211 [21190]
   Other proteins in same PDB: d1hyxh1, d1hyxh2, d1hyxl1
   part of hydrolytic antibody 6D9
   complexed with cpd

Details for d1hyxl2

PDB Entry: 1hyx, 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyxl2:

Sequence; same for both SEQRES and ATOM records:

>d1hyxl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1hyxl2:

• d1hyxl2 first appeared (with stable ids) in SCOP 1.55
  
• d1hyxl2 appears in SCOP 1.63
  
• d1hyxl2 appears in SCOP 1.67
  
• d1hyxl2 last appears in SCOP 1.73