Lineage for d3is8e_ (3is8 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485319Protein automated matches [190041] (24 species)
    not a true protein
  7. 1485644Species Pseudomonas aeruginosa [TaxId:287] [189215] (5 PDB entries)
  8. 1485685Domain d3is8e_: 3is8 E: [211879]
    automated match to d4e6kf_
    complexed with fe2, hem, k, so4

Details for d3is8e_

PDB Entry: 3is8 (more details), 2.25 Å

PDB Description: structure of mineralized bfrb soaked with feso4 from pseudomonas aeruginosa to 2.25a resolution
PDB Compounds: (E:) bacterioferritin

SCOPe Domain Sequences for d3is8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3is8e_ a.25.1.1 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
dileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d3is8e_:

Click to download the PDB-style file with coordinates for d3is8e_.
(The format of our PDB-style files is described here.)

Timeline for d3is8e_: