SCOPe 2.08: Domain d3is5d1: 3is5 D:130-394

Lineage for d3is5d1 (3is5 D:130-394)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:508771] [225773] (1 PDB entry)

8. Domain d3is5d1: 3is5 D:130-394 [211872]
   Other proteins in same PDB: d3is5a2, d3is5b2, d3is5c2, d3is5d2, d3is5e2, d3is5f2
   automated match to d2y4pc_
   complexed with anp, ca, gol, mg

Details for d3is5d1

PDB Entry: 3is5, 2.55 Å

PDB Description: crystal structure of cdpk kinase domain from toxoplasma gondii, tgme49_018720

PDB Compounds: (D:) Calcium-dependent protein kinase

SCOPe Domain Sequences for d3is5d1:

Sequence, based on SEQRES records:

>d3is5d1 d.144.1.0 (D:130-394) automated matches {Toxoplasma gondii [TaxId: 508771]}
tiddlfifkrklgsgafgdvhlveerssglerviktinkdrsqvpmeqieaeievlksld
hpniikifevfedyhnmyivmetceggellerivsaqargkalsegyvaelmkqmmnala
yfhsqhvvhkdlkpenilfqdtsphspikiidfglaelfksdehstnaagtalymapevf
krdvtfkcdiwsagvvmyflltgclpftgtsleevqqkatykepnyavecrpltpqavdl
lkqmltkdperrpsaaqvlhhewfk

Sequence, based on observed residues (ATOM records):

>d3is5d1 d.144.1.0 (D:130-394) automated matches {Toxoplasma gondii [TaxId: 508771]}
tiddlfifkrklgsgafgdvhlveerssglerviktinkdrsqvpmeqieaeievlksld
hpniikifevfedyhnmyivmetceggellerivsaqargkalsegyvaelmkqmmnala
yfhsqhvvhkdlkpenilfqdtsphspikiidfgalymapevfkrdvtfkcdiwsagvvm
yflltgclpftgepnypltpqavdllkqmltkdperrpsaaqvlhhewfk

Timeline for d3is5d1:

• d3is5d1 first appeared in SCOPe 2.03, called d3is5d_
  
• d3is5d1 appears in SCOPe 2.07