Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [225773] (1 PDB entry) |
Domain d3is5b1: 3is5 B:130-396 [211870] Other proteins in same PDB: d3is5a2, d3is5b2, d3is5c2, d3is5d2, d3is5e2, d3is5f2 automated match to d2y4pc_ complexed with anp, ca, gol, mg |
PDB Entry: 3is5 (more details), 2.55 Å
SCOPe Domain Sequences for d3is5b1:
Sequence, based on SEQRES records: (download)
>d3is5b1 d.144.1.0 (B:130-396) automated matches {Toxoplasma gondii [TaxId: 508771]} tiddlfifkrklgsgafgdvhlveerssglerviktinkdrsqvpmeqieaeievlksld hpniikifevfedyhnmyivmetceggellerivsaqargkalsegyvaelmkqmmnala yfhsqhvvhkdlkpenilfqdtsphspikiidfglaelfksdehstnaagtalymapevf krdvtfkcdiwsagvvmyflltgclpftgtsleevqqkatykepnyavecrpltpqavdl lkqmltkdperrpsaaqvlhhewfkqa
>d3is5b1 d.144.1.0 (B:130-396) automated matches {Toxoplasma gondii [TaxId: 508771]} tiddlfifkrklgsgafgdvhlveerssglerviktinkdrsqvpmeqieaeievlksld hpniikifevfedyhnmyivmetceggellerivsaqargkalsegyvaelmkqmmnala yfhsqhvvhkdlkpenilfqdtsphspikiidfglaelfkagtalymapevfkrdvtfkc diwsagvvmyflltgclpftgtsleevqqkatykepnyapltpqavdllkqmltkdperr psaaqvlhhewfkqa
Timeline for d3is5b1: