Lineage for d3irrd_ (3irr D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721826Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 1721859Protein automated matches [190680] (2 species)
    not a true protein
  7. 1721860Species Human (Homo sapiens) [TaxId:9606] [225893] (3 PDB entries)
  8. 1721864Domain d3irrd_: 3irr D: [211858]
    automated match to d1qbjc_
    protein/DNA complex; protein/RNA complex; complexed with epe

Details for d3irrd_

PDB Entry: 3irr (more details), 2.65 Å

PDB Description: Crystal Structure of a Z-Z junction (with HEPES intercalating)
PDB Compounds: (D:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d3irrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3irrd_ a.4.5.19 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
kiav

SCOPe Domain Coordinates for d3irrd_:

Click to download the PDB-style file with coordinates for d3irrd_.
(The format of our PDB-style files is described here.)

Timeline for d3irrd_: