SCOPe 2.08: Domain d3irrc1: 3irr C:140-198

Lineage for d3irrc1 (3irr C:140-198)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
   Pfam PF02295

6. Protein automated matches [190680] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225893] (3 PDB entries)

8. Domain d3irrc1: 3irr C:140-198 [211857]
   Other proteins in same PDB: d3irra2, d3irrb2, d3irrc2, d3irrd2
   automated match to d1qbjc_
   protein/DNA complex; protein/RNA complex; complexed with epe

Details for d3irrc1

PDB Entry: 3irr, 2.65 Å

PDB Description: Crystal Structure of a Z-Z junction (with HEPES intercalating)

PDB Compounds: (C:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d3irrc1:

Sequence; same for both SEQRES and ATOM records:

>d3irrc1 a.4.5.19 (C:140-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwkia

Timeline for d3irrc1:

• d3irrc1 first appeared in SCOPe 2.03, called d3irrc_
  
• d3irrc1 appears in SCOPe 2.07