Lineage for d3irqd_ (3irq D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259114Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 1259147Protein automated matches [190680] (2 species)
    not a true protein
  7. 1259148Species Human (Homo sapiens) [TaxId:9606] [225893] (2 PDB entries)
  8. 1259156Domain d3irqd_: 3irq D: [211854]
    automated match to d1qbjc_
    protein/DNA complex; protein/RNA complex

Details for d3irqd_

PDB Entry: 3irq (more details), 2.8 Å

PDB Description: Crystal structure of a Z-Z junction
PDB Compounds: (D:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d3irqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3irqd_ a.4.5.19 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
kiav

SCOPe Domain Coordinates for d3irqd_:

Click to download the PDB-style file with coordinates for d3irqd_.
(The format of our PDB-style files is described here.)

Timeline for d3irqd_: