SCOP 1.63: Domain d1yegh2: 1yeg H:114-223

Lineage for d1yegh2 (1yeg H:114-223)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab D2.5 (mouse), kappa L chain [49047] (4 PDB entries)

8. Domain d1yegh2: 1yeg H:114-223 [21185]
   Other proteins in same PDB: d1yegh1, d1yegl1
   complexed with act, bpn, zn

Details for d1yegh2

PDB Entry: 1yeg, 2 Å

PDB Description: structure of igg2a fab fragment (d2.3) complexed with reaction product

SCOP Domain Sequences for d1yegh2:

Sequence; same for both SEQRES and ATOM records:

>d1yegh2 b.1.1.2 (H:114-223) Immunoglobulin (constant domains of L and H chains) {Fab D2.5 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1yegh2:

• d1yegh2 first appeared (with stable ids) in SCOP 1.55
  
• d1yegh2 appears in SCOP 1.61
  
• d1yegh2 appears in SCOP 1.65
  
• d1yegh2 appears in the current release, SCOPe 2.08