Lineage for d3ir4a2 (3ir4 A:76-215)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1271151Protein automated matches [226848] (9 species)
    not a true protein
  7. 1271246Species Salmonella enterica [TaxId:99287] [225743] (1 PDB entry)
  8. 1271247Domain d3ir4a2: 3ir4 A:76-215 [211846]
    Other proteins in same PDB: d3ir4a1
    automated match to d1g7oa1
    complexed with cl, gsh, so4

Details for d3ir4a2

PDB Entry: 3ir4 (more details), 1.2 Å

PDB Description: 1.2 angstrom crystal structure of the glutaredoxin 2 (grxb) from salmonella typhimurium in complex with glutathione
PDB Compounds: (A:) glutaredoxin 2

SCOPe Domain Sequences for d3ir4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ir4a2 a.45.1.1 (A:76-215) automated matches {Salmonella enterica [TaxId: 99287]}
plltgkrnpaieewlrkvngyvnqlllprfaksafdefstpaarqyfirkkeassgsfdn
hlahsaglikkigddlrlldklivqpnavngelseddihlfpllrnltlvagihwptkva
dyrdnmakqtqinllssmai

SCOPe Domain Coordinates for d3ir4a2:

Click to download the PDB-style file with coordinates for d3ir4a2.
(The format of our PDB-style files is described here.)

Timeline for d3ir4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ir4a1