| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (9 species) not a true protein |
| Species Salmonella enterica [TaxId:99287] [225743] (1 PDB entry) |
| Domain d3ir4a2: 3ir4 A:76-215 [211846] Other proteins in same PDB: d3ir4a1 automated match to d1g7oa1 complexed with cl, gsh, so4 |
PDB Entry: 3ir4 (more details), 1.2 Å
SCOPe Domain Sequences for d3ir4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ir4a2 a.45.1.1 (A:76-215) automated matches {Salmonella enterica [TaxId: 99287]}
plltgkrnpaieewlrkvngyvnqlllprfaksafdefstpaarqyfirkkeassgsfdn
hlahsaglikkigddlrlldklivqpnavngelseddihlfpllrnltlvagihwptkva
dyrdnmakqtqinllssmai
Timeline for d3ir4a2: