SCOPe 2.03: Domain d3ir4a2: 3ir4 A:76-215

Lineage for d3ir4a2 (3ir4 A:76-215)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (9 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [225743] (1 PDB entry)

8. Domain d3ir4a2: 3ir4 A:76-215 [211846]
   Other proteins in same PDB: d3ir4a1
   automated match to d1g7oa1
   complexed with cl, gsh, so4

Details for d3ir4a2

PDB Entry: 3ir4, 1.2 Å

PDB Description: 1.2 angstrom crystal structure of the glutaredoxin 2 (grxb) from salmonella typhimurium in complex with glutathione

PDB Compounds: (A:) glutaredoxin 2

SCOPe Domain Sequences for d3ir4a2:

Sequence; same for both SEQRES and ATOM records:

>d3ir4a2 a.45.1.1 (A:76-215) automated matches {Salmonella enterica [TaxId: 99287]}
plltgkrnpaieewlrkvngyvnqlllprfaksafdefstpaarqyfirkkeassgsfdn
hlahsaglikkigddlrlldklivqpnavngelseddihlfpllrnltlvagihwptkva
dyrdnmakqtqinllssmai

Timeline for d3ir4a2:

• d3ir4a2 is new in SCOPe 2.03-stable
  
• d3ir4a2 appears in SCOPe 2.04
  
• d3ir4a2 appears in the current release, SCOPe 2.08