Lineage for d3ir4a1 (3ir4 A:-2-75)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370745Species Salmonella enterica [TaxId:99287] [225742] (1 PDB entry)
  8. 1370746Domain d3ir4a1: 3ir4 A:-2-75 [211845]
    Other proteins in same PDB: d3ir4a2
    automated match to d1g7oa2
    complexed with cl, gsh, so4

Details for d3ir4a1

PDB Entry: 3ir4 (more details), 1.2 Å

PDB Description: 1.2 angstrom crystal structure of the glutaredoxin 2 (grxb) from salmonella typhimurium in complex with glutathione
PDB Compounds: (A:) glutaredoxin 2

SCOPe Domain Sequences for d3ir4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ir4a1 c.47.1.0 (A:-2-75) automated matches {Salmonella enterica [TaxId: 99287]}
snamklyiydhcpfcvkarmifglknipvelnvlqnddeatptrmigqkmvpilqkddsr
ylpesmdivhyvdnldgk

SCOPe Domain Coordinates for d3ir4a1:

Click to download the PDB-style file with coordinates for d3ir4a1.
(The format of our PDB-style files is described here.)

Timeline for d3ir4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ir4a2