SCOPe 2.03: Domain d3ir4a1: 3ir4 A:-2-75

Lineage for d3ir4a1 (3ir4 A:-2-75)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [225742] (1 PDB entry)

8. Domain d3ir4a1: 3ir4 A:-2-75 [211845]
   Other proteins in same PDB: d3ir4a2
   automated match to d1g7oa2
   complexed with cl, gsh, so4

Details for d3ir4a1

PDB Entry: 3ir4, 1.2 Å

PDB Description: 1.2 angstrom crystal structure of the glutaredoxin 2 (grxb) from salmonella typhimurium in complex with glutathione

PDB Compounds: (A:) glutaredoxin 2

SCOPe Domain Sequences for d3ir4a1:

Sequence; same for both SEQRES and ATOM records:

>d3ir4a1 c.47.1.0 (A:-2-75) automated matches {Salmonella enterica [TaxId: 99287]}
snamklyiydhcpfcvkarmifglknipvelnvlqnddeatptrmigqkmvpilqkddsr
ylpesmdivhyvdnldgk

Timeline for d3ir4a1:

• d3ir4a1 is new in SCOPe 2.03-stable
  
• d3ir4a1 appears in SCOPe 2.04
  
• d3ir4a1 appears in the current release, SCOPe 2.08