SCOPe 2.03: Domain d3iq1d_: 3iq1 D:

Lineage for d3iq1d_ (3iq1 D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (19 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [225741] (1 PDB entry)

8. Domain d3iq1d_: 3iq1 D: [211844]
   automated match to d1dpsa_
   complexed with cl

Details for d3iq1d_

PDB Entry: 3iq1, 1.67 Å

PDB Description: Crystal structure of DPS protein from Vibrio cholerae O1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins

PDB Compounds: (D:) Dps family protein

SCOPe Domain Sequences for d3iq1d_:

Sequence; same for both SEQRES and ATOM records:

>d3iq1d_ a.25.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 243277]}
snamatnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiy
tdlqlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhq
qrdilelagetgdegtsalmsdyireqeklvwmlnawlk

Timeline for d3iq1d_:

• d3iq1d_ is new in SCOPe 2.03-stable
  
• d3iq1d_ appears in SCOPe 2.04
  
• d3iq1d_ appears in the current release, SCOPe 2.08, called d3iq1d1