| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Vibrio cholerae [TaxId:243277] [225741] (1 PDB entry) |
| Domain d3iq1d1: 3iq1 D:1-156 [211844] Other proteins in same PDB: d3iq1b2, d3iq1c2, d3iq1d2 automated match to d1dpsa_ complexed with cl |
PDB Entry: 3iq1 (more details), 1.67 Å
SCOPe Domain Sequences for d3iq1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iq1d1 a.25.1.0 (D:1-156) automated matches {Vibrio cholerae [TaxId: 243277]}
matnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiytdl
qlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhqqrd
ilelagetgdegtsalmsdyireqeklvwmlnawlk
Timeline for d3iq1d1: