Lineage for d1yegl2 (1yeg L:108-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221471Species Fab D2.5 (mouse), kappa L chain [49047] (4 PDB entries)
  8. 221475Domain d1yegl2: 1yeg L:108-214 [21184]
    Other proteins in same PDB: d1yegh1, d1yegl1

Details for d1yegl2

PDB Entry: 1yeg (more details), 2 Å

PDB Description: structure of igg2a fab fragment (d2.3) complexed with reaction product

SCOP Domain Sequences for d1yegl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yegl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab D2.5 (mouse), kappa L chain}
rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1yegl2:

Click to download the PDB-style file with coordinates for d1yegl2.
(The format of our PDB-style files is described here.)

Timeline for d1yegl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yegl1