Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab D2.5 (mouse), kappa L chain [49047] (4 PDB entries) |
Domain d1yegl2: 1yeg L:108-214 [21184] Other proteins in same PDB: d1yegh1, d1yegl1 |
PDB Entry: 1yeg (more details), 2 Å
SCOP Domain Sequences for d1yegl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yegl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab D2.5 (mouse), kappa L chain} rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1yegl2: