Lineage for d1yegl2 (1yeg L:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749038Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2749115Domain d1yegl2: 1yeg L:108-214 [21184]
    Other proteins in same PDB: d1yegh1, d1yegh2, d1yegl1
    part of Fab D2.5
    complexed with act, bpn, zn

Details for d1yegl2

PDB Entry: 1yeg (more details), 2 Å

PDB Description: structure of igg2a fab fragment (d2.3) complexed with reaction product
PDB Compounds: (L:) igg2a fab fragment

SCOPe Domain Sequences for d1yegl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yegl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1yegl2:

Click to download the PDB-style file with coordinates for d1yegl2.
(The format of our PDB-style files is described here.)

Timeline for d1yegl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yegl1