![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:176299] [225916] (8 PDB entries) |
![]() | Domain d3ip6a1: 3ip6 A:2-348 [211836] Other proteins in same PDB: d3ip6a2 automated match to d1usga_ complexed with pro, so4 |
PDB Entry: 3ip6 (more details), 1.4 Å
SCOPe Domain Sequences for d3ip6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ip6a1 c.93.1.0 (A:2-348) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} dvviavgapltgpnaafgaqiqkgaeqaakdinaaggingeqikivlgddvsdpkqgisv ankfvadgvkfvvghfnsgvsipasevyaengileitpaatnpvfterglwntfrtcgrd dqqggiagkyladhfkdakvaiihdktpygqgladetkkaanaagvtevmyegvnvgdkd fsaliskmkeagvsiiywgglhteagliirqaadqglkaklvsgdgivsnelasiagdav egtlntfgpdptlrpenkelvekfkaagfnpeaytlysyaamqaiagaakaagsvepekv aealkkgsfptalgeisfdekgdpklpgyvmyewkkgpdgkftyiqq
Timeline for d3ip6a1: