SCOP 1.61: Domain d1yefh2: 1yef H:114-223

Lineage for d1yefh2 (1yef H:114-223)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab D2.5 (mouse), kappa L chain [49047] (4 PDB entries)

8. Domain d1yefh2: 1yef H:114-223 [21183]
   Other proteins in same PDB: d1yefh1, d1yefl1

Details for d1yefh2

PDB Entry: 1yef, 2 Å

PDB Description: structure of igg2a fab fragment (d2.3) complexed with substrate analogue

SCOP Domain Sequences for d1yefh2:

Sequence; same for both SEQRES and ATOM records:

>d1yefh2 b.1.1.2 (H:114-223) Immunoglobulin (constant domains of L and H chains) {Fab D2.5 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1yefh2:

• d1yefh2 first appeared (with stable ids) in SCOP 1.55
  
• d1yefh2 appears in SCOP 1.59
  
• d1yefh2 appears in SCOP 1.63
  
• d1yefh2 appears in the current release, SCOPe 2.08