Lineage for d3inpa_ (3inp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079859Species Francisella tularensis [TaxId:119856] [225740] (1 PDB entry)
  8. 2079860Domain d3inpa_: 3inp A: [211826]
    automated match to d2flig_
    complexed with cl, so4

Details for d3inpa_

PDB Entry: 3inp (more details), 2.05 Å

PDB Description: 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3- epimerase from francisella tularensis.
PDB Compounds: (A:) D-ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d3inpa_:

Sequence, based on SEQRES records: (download)

>d3inpa_ c.1.2.0 (A:) automated matches {Francisella tularensis [TaxId: 119856]}
hiqinpsilsadlarlgddvkavlaagadnihfdvmdnhyvpnltfgpmvlkalrdygit
agmdvhlmvkpvdaliesfakagatsivfhpeasehidrslqliksfgiqaglalnpatg
idclkyvesnidrvlimsvnpgfggqkfipamldkakeiskwisstdrdilleidggvnp
yniaeiavcgvnafvagsaifnsdsykqtidkmrdelnkv

Sequence, based on observed residues (ATOM records): (download)

>d3inpa_ c.1.2.0 (A:) automated matches {Francisella tularensis [TaxId: 119856]}
hiqinpsilsadlarlgddvkavlaagadnihfdvmdnhyvpnltfgpmvlkalrdygit
agmdvhlmvkpvdaliesfakagatsivfhpeasehidrslqliksfgiqaglalnpatg
idclkyvesnidrvlimsvnpgfqkfipamldkakeiskwisstdrdilleidggvnpyn
iaeiavcgvnafvagsaifnsdsykqtidkmrdelnkv

SCOPe Domain Coordinates for d3inpa_:

Click to download the PDB-style file with coordinates for d3inpa_.
(The format of our PDB-style files is described here.)

Timeline for d3inpa_: