Lineage for d3inna1 (3inn A:1-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860854Species Brucella melitensis [TaxId:29459] [225767] (1 PDB entry)
  8. 2860855Domain d3inna1: 3inn A:1-282 [211822]
    Other proteins in same PDB: d3inna2, d3innb2, d3innc2, d3innd2
    automated match to d3mueb_
    complexed with atp, unx

Details for d3inna1

PDB Entry: 3inn (more details), 2.1 Å

PDB Description: Crystal structure of pantoate-beta-alanine-ligase in complex with ATP at low occupancy at 2.1 A resolution
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3inna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3inna1 c.26.1.0 (A:1-282) automated matches {Brucella melitensis [TaxId: 29459]}
mqiihtieelrqalaparqqgkkigfvptmgylhkghlelvrrarvendvtlvsifvnpl
qfganedlgryprdlerdagllhdaqvdylfaptvsdmyprpmqtvvdvpplgnqiegea
rpghfagvatvvsklfnivgpdaayfgekdfqqlviirrmvddmaipvrivgvetvredd
glacssrnvyltpeqrraaiivpqaldeadrlyrsgmddpdaleaairtfigrqplavpe
viairdpetlerlpalqgrpilvalfvrvgatrlldnrvigh

SCOPe Domain Coordinates for d3inna1:

Click to download the PDB-style file with coordinates for d3inna1.
(The format of our PDB-style files is described here.)

Timeline for d3inna1: