| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Brucella melitensis [TaxId:29459] [225767] (1 PDB entry) |
| Domain d3inna1: 3inn A:1-282 [211822] Other proteins in same PDB: d3inna2, d3innb2, d3innc2, d3innd2 automated match to d3mueb_ complexed with atp, unx |
PDB Entry: 3inn (more details), 2.1 Å
SCOPe Domain Sequences for d3inna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3inna1 c.26.1.0 (A:1-282) automated matches {Brucella melitensis [TaxId: 29459]}
mqiihtieelrqalaparqqgkkigfvptmgylhkghlelvrrarvendvtlvsifvnpl
qfganedlgryprdlerdagllhdaqvdylfaptvsdmyprpmqtvvdvpplgnqiegea
rpghfagvatvvsklfnivgpdaayfgekdfqqlviirrmvddmaipvrivgvetvredd
glacssrnvyltpeqrraaiivpqaldeadrlyrsgmddpdaleaairtfigrqplavpe
viairdpetlerlpalqgrpilvalfvrvgatrlldnrvigh
Timeline for d3inna1: