SCOPe 2.07: Domain d3imxa2: 3imx A:219-461

Lineage for d3imxa2 (3imx A:219-461)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries)

8. Domain d3imxa2: 3imx A:219-461 [211821]
   Other proteins in same PDB: d3imxa3
   automated match to d1bdga2
   complexed with b84, glc, na

Details for d3imxa2

PDB Entry: 3imx, 2 Å

PDB Description: crystal structure of human glucokinase in complex with a synthetic activator

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d3imxa2:

Sequence; same for both SEQRES and ATOM records:

>d3imxa2 c.55.1.0 (A:219-461) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
kac

Timeline for d3imxa2:

• d3imxa2 first appeared in SCOPe 2.03
  
• d3imxa2 appears in SCOPe 2.06
  
• d3imxa2 appears in the current release, SCOPe 2.08