| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (40 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [225630] (7 PDB entries) |
| Domain d3il9b1: 3il9 B:1-174 [211815] automated match to d1mzja1 |
PDB Entry: 3il9 (more details), 1.85 Å
SCOPe Domain Sequences for d3il9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3il9b1 c.95.1.0 (B:1-174) automated matches {Escherichia coli [TaxId: 83333]}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi
Timeline for d3il9b1: