![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [225630] (7 PDB entries) |
![]() | Domain d3il9a2: 3il9 A:175-317 [211814] automated match to d1mzja2 |
PDB Entry: 3il9 (more details), 1.85 Å
SCOPe Domain Sequences for d3il9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3il9a2 c.95.1.0 (A:175-317) automated matches {Escherichia coli K-12 [TaxId: 83333]} isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik pgqlvlleafgggftwgsalvrf
Timeline for d3il9a2: