Lineage for d3il9a2 (3il9 A:175-317)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917643Species Escherichia coli K-12 [TaxId:83333] [225630] (7 PDB entries)
  8. 2917647Domain d3il9a2: 3il9 A:175-317 [211814]
    automated match to d1mzja2

Details for d3il9a2

PDB Entry: 3il9 (more details), 1.85 Å

PDB Description: structure of e. coli fabh
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d3il9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3il9a2 c.95.1.0 (A:175-317) automated matches {Escherichia coli K-12 [TaxId: 83333]}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

SCOPe Domain Coordinates for d3il9a2:

Click to download the PDB-style file with coordinates for d3il9a2.
(The format of our PDB-style files is described here.)

Timeline for d3il9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3il9a1