Lineage for d1yedb2 (1yed B:116-217)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159788Species Fab D2.4 (mouse), kappa L chain [49046] (1 PDB entry)
  8. 159790Domain d1yedb2: 1yed B:116-217 [21181]
    Other proteins in same PDB: d1yeda1, d1yedb1, d1yedh1, d1yedl1

Details for d1yedb2

PDB Entry: 1yed (more details), 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)

SCOP Domain Sequences for d1yedb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yedb2 b.1.1.2 (B:116-217) Immunoglobulin (constant domains of L and H chains) {Fab D2.4 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1yedb2:

Click to download the PDB-style file with coordinates for d1yedb2.
(The format of our PDB-style files is described here.)

Timeline for d1yedb2: