SCOPe 2.04: Domain d3il7a1: 3il7 A:1-175

Lineage for d3il7a1 (3il7 A:1-175)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225739] (1 PDB entry)

8. Domain d3il7a1: 3il7 A:1-175 [211809]
   automated match to d1ub7a1

Details for d3il7a1

PDB Entry: 3il7, 2.6 Å

PDB Description: Crystal structure of S. aureus FabH

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d3il7a1:

Sequence; same for both SEQRES and ATOM records:

>d3il7a1 c.95.1.0 (A:1-175) automated matches {Staphylococcus aureus [TaxId: 1280]}
mnvgikgfgayapekiidnayfeqfldtsdewiskmtgikerhwadddqdtsdlayeasv
kaiadagiqpedidmiivatatgdmpfptvanmlqerlgtgkvasmdqlaacsgfmysmi
takqyvqsgdyhnilvvgadklskitdltdrstavlfgdgagaviigevsegrgi

Timeline for d3il7a1:

• d3il7a1 first appeared in SCOPe 2.03
  
• d3il7a1 appears in SCOPe 2.05
  
• d3il7a1 appears in the current release, SCOPe 2.08