SCOPe 2.07: Domain d3ikrc2: 3ikr C:235-355

Lineage for d3ikrc2 (3ikr C:235-355)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (11 PDB entries)

8. Domain d3ikrc2: 3ikr C:235-355 [211808]
   Other proteins in same PDB: d3ikra1, d3ikrb1, d3ikrc1
   automated match to d1pwba1
   complexed with ca, man

Details for d3ikrc2

PDB Entry: 3ikr, 1.65 Å

PDB Description: crystal structure of alpha 1-4 mannobiose bound trimeric human lung surfactant protein d

PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikrc2:

Sequence; same for both SEQRES and ATOM records:

>d3ikrc2 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d3ikrc2:

• d3ikrc2 first appeared in SCOPe 2.03
  
• d3ikrc2 appears in SCOPe 2.06
  
• d3ikrc2 appears in the current release, SCOPe 2.08