| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
| Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
| Protein Surfactant protein [57949] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) |
| Domain d3ikrb1: 3ikr B:205-234 [211805] Other proteins in same PDB: d3ikra2, d3ikrb2, d3ikrc2 automated match to d1pwba2 complexed with ca, man |
PDB Entry: 3ikr (more details), 1.65 Å
SCOPe Domain Sequences for d3ikrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ikrb1 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d3ikrb1:
View in 3DDomains from other chains: (mouse over for more information) d3ikra1, d3ikra2, d3ikrc1, d3ikrc2 |