SCOPe 2.07: Domain d3ikra1: 3ikr A:204-234

Lineage for d3ikra1 (3ikr A:204-234)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)

8. Domain d3ikra1: 3ikr A:204-234 [211803]
   Other proteins in same PDB: d3ikra2, d3ikrb2, d3ikrc2
   automated match to d1pwba2
   complexed with ca, man

Details for d3ikra1

PDB Entry: 3ikr, 1.65 Å

PDB Description: crystal structure of alpha 1-4 mannobiose bound trimeric human lung surfactant protein d

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikra1:

Sequence; same for both SEQRES and ATOM records:

>d3ikra1 h.1.1.1 (A:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d3ikra1:

• d3ikra1 first appeared in SCOPe 2.03
  
• d3ikra1 appears in SCOPe 2.06
  
• d3ikra1 appears in the current release, SCOPe 2.08