| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
| Domain d1yeda2: 1yed A:111-222 [21180] Other proteins in same PDB: d1yeda1, d1yedb1, d1yedb2, d1yedh1, d1yedh2, d1yedl1 part of Fab D2.4 complexed with pnb |
PDB Entry: 1yed (more details), 3.1 Å
SCOP Domain Sequences for d1yeda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeda2 b.1.1.2 (A:111-222) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1yeda2: