Lineage for d1yeda2 (1yed A:111-222)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289933Domain d1yeda2: 1yed A:111-222 [21180]
    Other proteins in same PDB: d1yeda1, d1yedb1, d1yedb2, d1yedh1, d1yedh2, d1yedl1
    part of Fab D2.4
    complexed with pnb

Details for d1yeda2

PDB Entry: 1yed (more details), 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)

SCOP Domain Sequences for d1yeda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeda2 b.1.1.2 (A:111-222) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1yeda2:

Click to download the PDB-style file with coordinates for d1yeda2.
(The format of our PDB-style files is described here.)

Timeline for d1yeda2: