Lineage for d1yeda2 (1yed A:111-222)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8905Species Fab D2.4 (mouse), kappa L chain [49046] (1 PDB entry)
  8. 8906Domain d1yeda2: 1yed A:111-222 [21180]
    Other proteins in same PDB: d1yeda1, d1yedb1, d1yedh1, d1yedl1

Details for d1yeda2

PDB Entry: 1yed (more details), 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)

SCOP Domain Sequences for d1yeda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeda2 b.1.1.2 (A:111-222) Immunoglobulin (constant domains of L and H chains) {Fab D2.4 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1yeda2:

Click to download the PDB-style file with coordinates for d1yeda2.
(The format of our PDB-style files is described here.)

Timeline for d1yeda2: