SCOPe 2.07: Domain d3ikna1: 3ikn A:204-234

Lineage for d3ikna1 (3ikn A:204-234)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)

8. Domain d3ikna1: 3ikn A:204-234 [211785]
   Other proteins in same PDB: d3ikna2, d3iknb2, d3iknc2
   automated match to d1pwba2
   complexed with ca, gal

Details for d3ikna1

PDB Entry: 3ikn, 1.6 Å

PDB Description: crystal structure of galactose bound trimeric human lung surfactant protein d

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikna1:

Sequence; same for both SEQRES and ATOM records:

>d3ikna1 h.1.1.1 (A:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d3ikna1:

• d3ikna1 first appeared in SCOPe 2.03
  
• d3ikna1 appears in SCOPe 2.06
  
• d3ikna1 appears in the current release, SCOPe 2.08