SCOPe 2.07: Domain d3ikhc1: 3ikh C:2-285

Lineage for d3ikhc1 (3ikh C:2-285)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [225726] (2 PDB entries)

8. Domain d3ikhc1: 3ikh C:2-285 [211783]
   Other proteins in same PDB: d3ikha2, d3ikhb2, d3ikhc2, d3ikhd2
   automated match to d2fv7a1
   complexed with atp, gol

Details for d3ikhc1

PDB Entry: 3ikh, 1.88 Å

PDB Description: crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae

PDB Compounds: (C:) carbohydrate kinase

SCOPe Domain Sequences for d3ikhc1:

Sequence; same for both SEQRES and ATOM records:

>d3ikhc1 c.72.1.0 (C:2-285) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
rvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaatg
ndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldemi
phmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiavv
neseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmlas
allrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt

Timeline for d3ikhc1:

• d3ikhc1 first appeared in SCOPe 2.03, called d3ikhc_
  
• d3ikhc1 appears in SCOPe 2.06
  
• d3ikhc1 appears in the current release, SCOPe 2.08