Lineage for d3ikhc_ (3ikh C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872643Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1872644Protein automated matches [190117] (37 species)
    not a true protein
  7. 1872737Species Klebsiella pneumoniae [TaxId:272620] [225726] (2 PDB entries)
  8. 1872740Domain d3ikhc_: 3ikh C: [211783]
    automated match to d2fv7a1
    complexed with atp, gol

Details for d3ikhc_

PDB Entry: 3ikh (more details), 1.88 Å

PDB Description: Crystal structure of Ribokinase in Complex with ATP and glycerol in the active site from Klebsiella pneumoniae
PDB Compounds: (C:) carbohydrate kinase

SCOPe Domain Sequences for d3ikhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikhc_ c.72.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
lrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaat
gndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldem
iphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiav
vneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmla
sallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt

SCOPe Domain Coordinates for d3ikhc_:

Click to download the PDB-style file with coordinates for d3ikhc_.
(The format of our PDB-style files is described here.)

Timeline for d3ikhc_: