Lineage for d3ikhc1 (3ikh C:2-285)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904733Species Klebsiella pneumoniae [TaxId:272620] [225726] (2 PDB entries)
  8. 2904736Domain d3ikhc1: 3ikh C:2-285 [211783]
    Other proteins in same PDB: d3ikha2, d3ikhb2, d3ikhc2, d3ikhd2
    automated match to d2fv7a1
    complexed with atp, gol

Details for d3ikhc1

PDB Entry: 3ikh (more details), 1.88 Å

PDB Description: crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
PDB Compounds: (C:) carbohydrate kinase

SCOPe Domain Sequences for d3ikhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikhc1 c.72.1.0 (C:2-285) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
rvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaatg
ndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldemi
phmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiavv
neseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmlas
allrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt

SCOPe Domain Coordinates for d3ikhc1:

Click to download the PDB-style file with coordinates for d3ikhc1.
(The format of our PDB-style files is described here.)

Timeline for d3ikhc1: